WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Rat VEGF-A/VEGF164 Protein - RP01323

Recombinant Rat VEGF-A/VEGF164 Protein - RP01323

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Rat VEGF-A/VEGF164 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01323-10, RP01323-20, RP01323-50, RP01323-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat VEGF-A/VEGF164 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg190) of Rat VEGFA (Accession #NP_001274037.1) fused with an 6×His tag at the C-terminus.

Alternate Names: MVCD1, VAS, vascular endothelial growth factor A, Vasculotropin, VEGF, VEGFA, VEGF-A, VEGFMGC70609, VPF, VEGFA

SWISS: P16612-2

GeneID: 83785

Species: Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Vascular endothelial growth factor A (VEGFA),also known as Vascular permeability factor (VPF). VEGFA belongs to the PDGF/VEGF growth factor family. VEGFA is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. VEGFA is produced by a group of three major isoforms as a result of alternative splicing and if any three isoforms are produced (VEGFA120, VEGFA164, and VEGFA188) then this will not result in vessel defects and death of the full VEGFA knockout in mice.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Rat VEGF164 at 1 μg/mL (100 μL/well) can bind Human KDR with a linear range of 0.03-3.6 ng/mL.|2.Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC). The ED50 for this effect is typically 0.02-0.10 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only