Skip to product information
1 of 1

ABclonal

Recombinant SARS-CoV-2 papain-like protease Protein - RP01274LQ

Recombinant SARS-CoV-2 papain-like protease Protein - RP01274LQ

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant SARS-CoV-2 papain-like protease Protein

Sizes: 10ug, 100ug

Catalogue Number: RP01274LQ-10, RP01274LQ-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met,a 6×His tag at the N-terminus.

Alternate Names: PLPro, PL-PRO, pp1a, Papain-like Protease, Replicase polyprotein 1a, ORF1a polyprotein, Plpro, COVID-19

GeneID: 43740578

Species: SARS-CoV-2

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.

Source: E. coli

Tag: N-His

Formulation: Supplied as a 0.22 μm filtered solution in 20mM Tris,20% Glycerol,10mM β-Me, pH7.5.Contact us for customized product form or formulation.

Antigen Sequence: EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details