Skip to product information
1 of 1

ABclonal

Recombinant SARS-CoV-2 Spike S1 Protein - RP01259

Recombinant SARS-CoV-2 Spike S1 Protein - RP01259

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant SARS-CoV-2 Spike S1 Protein

Sizes: 10ug, 100ug

Catalogue Number: RP01259-10, RP01259-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant SARS-CoV-2(2019-nCoV) Spike S1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val11-Arg682) of SARS-COV-2(2019-nCoV) Spike S1 (Accession #YP_009724390.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: Envelope, SARS-CoV-2 Spike RBD (N501Y), Spike, Spike ECD, Spike RBD, Spike S1, Spike S2, Spike S2 ECD, S1-RBD protein, NCP-CoV RBD Protein, novel coronavirus RBD Protein, 2019-nCoV RBD Protein, S glycoprotein Subunit1 RBD Protein

GeneID: 43740568

Species: SARS-CoV-2

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates thisinteraction.The S protein plays key parts in the induction of neutralizing-antibody and T-cellresponses, as well as protective immunity.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ACE2 at 2 μg/mL (100 μL/well) can bind Recombinant SARS-CoV-2 Spike S1, the EC50 of SARS-COV-2 Spike S1 is 6.79 ng/mL.|2.Immobilized Human ACE2 on COOH Chip can bind SARS-COV-2 Spike S1 with an affinity constant of 90.8 nM as determined in a SPR assay (Nicoya OpenSPR).

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. or Supplied as a 0.22 μm filtered solution in PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: VSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details