Recombinant SARS-CoV Spike RBD Protein
Sizes: 10ug, 100ug
Catalogue Number: RP01304-10, RP01304-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant SARS-CoV Spike RBD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg306-Phe527) of sars-cov Spike RBD (Accession #NP_828851.1) fused with mFc tag at the C-terminus.
Alternate Names: Spike, Spike RBD, Spike S1
SWISS: P59594
GeneID: 1489668
Species: SARS-CoV
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: It's been reported that Coronavirus can infect the human respiratory epithelial cells through interaction with the human ACE2 receptor. The spike protein is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV Spike RBD at 2μg/mL (100μL/well) can bind Human ACE2 (Catalog: RP01266) with a linear range of 0.1-11.56 ng/mL.
Source: HEK293 cells
Tag: C-mFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only