Elabscience
Recombinant Swine CXCL13 protein(N-His) - PKSS000023
Recombinant Swine CXCL13 protein(N-His) - PKSS000023
Couldn't load pickup availability
Recombinant Swine CXCL13 protein(N-His)
Size: 20μg
Catalogue Number: PKSS000023-20
Citations, Manuals and MSDS Available upon request.
Abbreviation: CXCL13
Target Symptom: C-X-C motif chemokine 13; Angie; B cell-attracting chemokine 1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13; BCA1; BLC; SCYB13
Target Species: Porcine
Expression Host: E.coli
Fusion Tag: N-His
UNIProt ID: A0A287A706
Accession: A0A287A706
Background: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
Sequence: MRFTLGSLLLVLLLACSLFPIHGVLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: Please contact us for more information.
Calculated MW: 13.32 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
