Skip to product information
1 of 1

Elabscience

Recombinant Swine CXCL13 protein(N-His) - PKSS000023

Recombinant Swine CXCL13 protein(N-His) - PKSS000023

Regular price $693.00 CAD
Regular price Sale price $693.00 CAD
Sale Sold out
Quantity

Get a quote

Recombinant Swine CXCL13 protein(N-His)

Size: 20μg

Catalogue Number: PKSS000023-20

Citations, Manuals and MSDS Available upon request.

Abbreviation: CXCL13

Target Symptom: C-X-C motif chemokine 13; Angie; B cell-attracting chemokine 1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13; BCA1; BLC; SCYB13

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: A0A287A706

Accession: A0A287A706

Background: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Sequence: MRFTLGSLLLVLLLACSLFPIHGVLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: Please contact us for more information.

Calculated MW: 13.32 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details