Recombinant Swine FGF-2 protein(N-His)(active)
Sizes: 5μg, 20μg
Catalogue Numbers: PKSS000016-5, PKSS000016-20
Citations, Manuals and MSDS Available upon request.
Abbreviation: FGF-2
Target Symptom: Fgfb; bFGF; FGF-basic
Target Species: Porcine
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P03969
Accession: P03969
Background: Fibroblast growth factor 2(FGF2) is a secreted protein and belongs to the heparin-binding growth factors family. FGF2 is produced by epithelial; tumor and other cell types. It involved in developmental processes and regulates differentiation; proliferation; and migration; FGF2 is a critical factor for growing embryonic stem cells in culture without inducing differentiation. FGF2 has a high affinity for heparan sulfate and binding is a step in the FGF basic activation of FGFR tyrosine kinase.
Activity: Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect is < 2 ng/mL.
Sequence: MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI
KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY
SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from a solution containing 0.01% sarkosyl in 1X PBS, pH 7.4.
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: Please contact us for more information.
Calculated MW: 18.07 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only