Elabscience
Recombinant Swine IFN gamma protein(N-His)(active) - PKSS000012
Recombinant Swine IFN gamma protein(N-His)(active) - PKSS000012
Couldn't load pickup availability
Recombinant Swine IFN gamma protein(N-His)(active)
Sizes: 5μg, 20μg
Catalogue Numbers: PKSS000012-5, PKSS000012-20
Citations, Manuals and MSDS Available upon request.
Abbreviation: IFN gamma
Target Symptom: IFN-gamma; IFNG
Target Species: Porcine
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P17803
Accession: P17803
Background: IFNγ is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them; leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens; mitogens; or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNγ synthesis is induced by IL-2; FGF-basic; and EGF.
Activity: Measure by its ability to protect PK15 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 40 pg/mL.
Sequence: MSYTTYFLAFQLCVTLCFSGSYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK
Purity: > 95 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: Please contact us for more information.
Calculated MW: 20.25 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
