WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Swine IFN gamma protein(N-His)(active) - PKSS000012
Recombinant Swine IFN gamma protein(N-His)(active) - PKSS000012

Recombinant Swine IFN gamma protein(N-His)(active) - PKSS000012

Regular price
$277.20
Regular price
Sale price
$277.20
Unit price
per 
Availability
Sold out

Recombinant Swine IFN gamma protein(N-His)(active)

Sizes: 5μg, 20μg

Catalogue Numbers: PKSS000012-5, PKSS000012-20

Citations, Manuals and MSDS Available upon request.

Abbreviation: IFN gamma

Target Symptom: IFN-gamma; IFNG

Target Species: Porcine

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: P17803

Accession: P17803

Background: IFNγ is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them; leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens; mitogens; or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNγ synthesis is induced by IL-2; FGF-basic; and EGF.

Activity: Measure by its ability to protect PK15 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 40 pg/mL.

Sequence: MSYTTYFLAFQLCVTLCFSGSYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK

Purity: > 95 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: Please contact us for more information.

Calculated MW: 20.25 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only