Skip to product information
1 of 2

Elabscience

Recombinant Swine IL-15 protein(N-His)(active) - PKSS000008

Recombinant Swine IL-15 protein(N-His)(active) - PKSS000008

Regular price $277.20 CAD
Regular price Sale price $277.20 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Swine IL-15 protein(N-His)(active) Sizes: 5μg, 20μg Catalogue Numbers: PKSS000008-5, PKSS000008-20 Citations, Manuals and MSDS Available upon request. Abbreviation: IL-15 Target Symptom: IL-T Target Species: Porcine Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: Q95253 Accession: Q95253 Background: Human Interleukin 15 (IL-15) is a cytokine that regulates T cell and natural killer cell activation and proliferation. IL-15 binds to the alpha subunit of the IL15 receptor (IL-15RA) with high affinity. IL-15 also binds to the beta and gamma chains of the IL-2 receptor, but not the alpha subunit of the IL2 receptor. IL-15 is structurally and functionally related to IL-2. Both cytokines share some subunits of receptors, allowing them to compete for and negatively regulate each other' s activity. The number of CD8+ memory T cells is controlled by a balance between IL-15 and IL-2. Despite their many overlapping functional properties, IL-2 and IL-15 are, in fact, quite distinct players in the immune system. IL-15 is constitutively expressed by a wide variety of cell types and tissues, including monocytes, macrophages and DCs. Mature Human IL-15 shares 70% amino acid sequence identity with Mouse and Rat IL-15. Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 5. 5 ng/mL. Sequence: MRILKPCLRSTCIQCYLCLLLNSHFLTEDGIHVFILGCISAGLPKTEATWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS Purity: > 95 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: Please contact us for more information. Calculated MW: 19.26 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only
View full details