Skip to product information
1 of 2

Elabscience

Recombinant Swine IL-6 protein(N-His)(active) - PKSS000005

Recombinant Swine IL-6 protein(N-His)(active) - PKSS000005

Regular price $277.20 CAD
Regular price Sale price $277.20 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Swine IL-6 protein(N-His)(active) Sizes: 5μg, 20μg Catalogue Numbers: PKSS000005-5, PKSS000005-20 Citations, Manuals and MSDS Available upon request. Abbreviation: IL-6 Target Symptom: IFN-β2; B-Cell Differentiation Factor (BCDF); BSF-2; HPGF; HSF; MGI-2 Target Species: Porcine Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: P26893 Accession: P26893 Background: Interleukin-6 (IL-6) is a multifunctional α -helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. It exerts actions through the its heterodimeric receptor composed of IL-6R that lacks the tyrosine/kinase domain and binds IL-6 with low affinity, and ubiquitously expressed glycoprotein 130 (gp130) that binds the IL-6. IL-6R complex with high affinity and thus transduces signals. IL-6 is also involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity. Activity: Measure by its ability to induce proliferation in T1165. 85. 2.1 cells. The ED50 for this effect is < 1. 5 ng/mL. Sequence: MNSLSTSAFSPVAFSLGLLLVMATAFPTPERLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: Please contact us for more information. Calculated MW: 24.78 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only
View full details