Skip to product information
1 of 2

Elabscience

Recombinant Swine TNF alpha protein(N-His)(active) - PKSS000010

Recombinant Swine TNF alpha protein(N-His)(active) - PKSS000010

Regular price $277.20 CAD
Regular price Sale price $277.20 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Swine TNF alpha protein(N-His)(active) Sizes: 5μg, 20μg Catalogue Numbers: PKSS000010-5, PKSS000010-20 Citations, Manuals and MSDS Available upon request. Abbreviation: TNF alpha Target Symptom: TNFSF2; Cachectin; Differentiation-inducing factor (DIF); Necrosin; Cytotoxin; TNSF1A Target Species: Porcine Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: P23563 Accession: P23563 Background: Tumor necrosis factor alpha (TNFα) is the prototypic ligand of the TNF superfamily. TNFα forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1, p55R) and TNF-R2 (TNF receptor type 2, p75R). TNFα is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFα is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells. Activity: Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED50 for this effect is < 15 pg/mL. Sequence: MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQKEEFPAGPLSINPLAQGLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: Please contact us for more information. Calculated MW: 26.08 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only
View full details