BioWorld
Recombinant VEGF165, Rat(CHO-expre Ssed) - BK0293
Recombinant VEGF165, Rat(CHO-expre Ssed) - BK0293
Couldn't load pickup availability
Recombinant VEGF165, Rat(CHO-expre Ssed)
Catalogue Numbers: BK0293-10, BK0293-50
Sizes: 10μg, 50μg
Source: CHO
Molecular Weight: 35-48 kDa, observed by non-reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity: ED50 < 4 ng/ml, measured in a cell proliferation assay using HUVEC cells, corresponding to a specific activity of >2.5 x 10ˆ5 units/mg
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIM
RIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCD
KPRR
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant Rat Vascular Endothelial Growth Factor 165 (VEGF165) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrVEGF165 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.