WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Yeast sumo Protein - RPT0010

Recombinant Yeast sumo Protein - RPT0010

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Yeast sumo Protein

Sizes: 50ug, 100ug

Catalogue Number: RPT0010-50, RPT0010-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Yeast sumo Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly98) of yeast sumo (Accession #NP_010798.1) fused with with His tag at the N-terminal.

Alternate Names: sumo

SWISS: Q12306

GeneID: 852122

Species: Yeast

Purity: ≥ 95% as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: E. coli

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only