ABclonal
Recombinant Yeast sumo Protein - RPT0010
Recombinant Yeast sumo Protein - RPT0010
Couldn't load pickup availability
Recombinant Yeast sumo Protein
Sizes: 50ug, 100ug
Catalogue Number: RPT0010-50, RPT0010-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Yeast sumo Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly98) of yeast sumo (Accession #NP_010798.1) fused with with His tag at the N-terminal.
Alternate Names: sumo
SWISS: Q12306
GeneID: 852122
Species: Yeast
Purity: ≥ 95% as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: E. coli
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
