Streptavidin Recombinant Protein - NCP0373

Streptavidin Recombinant Protein

Catalogue Number: NCP0373-500, NCP0373-1000

Sizes: 500ug, 1mg

Swiss-Prot: P22629

Host: E.coli

Tag: His-tag

AA Sequence: MRKIVVAAIAVSLTt VSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWt VAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Restriction Sites: NdeI-XhoI

Background: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~38kDa

Notes: For research use only, not for use in diagnostic procedure.