Recombinant Cynomolgus IgE Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RPT0037-20, RPT0037-50, RPT0037-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Cynomolgus IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys208-Lys429) of Cynomolgus IgE (Accession # G8F4W7) fused with His tag and Avi tag at the C-terminus.
Alternate Names: Ig-like domain-containing protein , EGM_20642, IgE
SWISS: G8F4W7
Species: Cynomolgus
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation.
Source: HEK293 cells
Tag: C-6His-Avi
Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).
Antigen Sequence: KCADSNPRGVSAYLSRPSPFDLFISKSPTITCLVVDLAPSKETVNLTWSRASGKPVPHIPATEKKQQRNGTLTVTSILPVVTQDWIEGETYQCRVIHPHLPRALVRSMTKTSGPRAAPEVYVFATPEKLESRDKRTLACLIENFMPEDISVQWLHSDVQLPDTRHSVTQPRKTKGSGFFVFSRLEVTKAEWEQKDEFICRAVHEAASPSWIVQQAVSVNPGK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only