Recombinant Cynomolgus Siglec-15/CD33L3 Protein
Sizes: 10ug, 50ug, 100ug
Catalogue Numbers: RP01292-10, RP01292-50, RP01292-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Cynomolgus Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of cynomolgus Siglec-15/CD33L3 (Accession #XP_005586866.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15, sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15
SWISS: A0A2K5UY47
GeneID: 102126346
Species: Cynomolgus
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,300mM NaCl, pH 7.4.
Antigen Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGPAHAFRALCTAEGEPPPALAWSGPALGNGSAAVPSSGQGHGHLVTAELPALNHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only