WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Cynomolgus Siglec-15/CD33L3 Protein - RP01294

Recombinant Cynomolgus Siglec-15/CD33L3 Protein - RP01294

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Cynomolgus Siglec-15/CD33L3 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01294-10, RP01294-20, RP01294-50, RP01294-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Cynomolgus Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of cynomolgus Siglec-15/CD33L3 (Accession #XP_005586866.1) fused with a 6×His tag at the C-terminus.

Alternate Names: sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15, sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15

SWISS: A0A2K5UY47

GeneID: 102126346

Species: Cynomolgus

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,0.1M Glycine, pH 9.0.

Antigen Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGPAHAFRALCTAEGEPPPALAWSGPALGNGSAAVPSSGQGHGHLVTAELPALNHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Endotoxin: Please contact us for more information.

Research Use Only