Recombinant Cynomolgus Siglec-15/CD33L3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01294-10, RP01294-20, RP01294-50, RP01294-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Cynomolgus Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of cynomolgus Siglec-15/CD33L3 (Accession #XP_005586866.1) fused with a 6×His tag at the C-terminus.
Alternate Names: sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15, sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15
SWISS: A0A2K5UY47
GeneID: 102126346
Species: Cynomolgus
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS,0.1M Glycine, pH 9.0.
Antigen Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGPAHAFRALCTAEGEPPPALAWSGPALGNGSAAVPSSGQGHGHLVTAELPALNHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Endotoxin: Please contact us for more information.
Research Use Only