Recombinant Human Activin RIIA/ACVR2A Protein
Sizes: 10ug, 50ug
Catalogue Number: RP01094-10, RP01094-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Activin RIIA/ACVR2A Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ala20-Pro134) of human ACVR2A (Accession #P27037) fused with a 6×His tag at the C-terminus.
Alternate Names: ACTRII, ACVR2, ACVR2A, ACVR2
SWISS: P27037
GeneID: 92
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKP
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only