WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Activin RIIA/ACVR2A Protein - RP01094

Recombinant Human Activin RIIA/ACVR2A Protein - RP01094

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Activin RIIA/ACVR2A Protein

Sizes: 10ug, 50ug

Catalogue Number: RP01094-10, RP01094-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Activin RIIA/ACVR2A Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ala20-Pro134) of human ACVR2A (Accession #P27037) fused with a 6×His tag at the C-terminus.

Alternate Names: ACTRII, ACVR2, ACVR2A, ACVR2

SWISS: P27037

GeneID: 92

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKP

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only