WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human ALK-7/ACVR1C Protein - RP00256

Recombinant Human ALK-7/ACVR1C Protein - RP00256

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human ALK-7/ACVR1C Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00256-10, RP00256-20, RP00256-50, RP00256-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human ALK-7/ACVR1C Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu22-Glu113) of human ALK-7 Protein (Accession #NP_660302.2) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: ACVR1C, ACVRLK7, ALK7

SWISS: Q8NER5

GeneID: 130399

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only