WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Amphiregulin/AREG Protein - RP00898

Recombinant Human Amphiregulin/AREG Protein - RP00898

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Amphiregulin/AREG Protein

Sizes: 10ug, 50ug

Catalogue Number: RP00898-10, RP00898-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Amphiregulin/AREG Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser101-Lys198) of Human Amphiregulin/AREG (Accession #P15514) fused with an initial Met at the N-terminus.

Alternate Names: AREG, AR, AREGB, CRDGF, SDGF, amphiregulin

SWISS: P15514

GeneID: 374

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 5-15 ng/mL.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only