Recombinant Human Angiopoietin-like 7/ANGPTL7(27-346) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00206-10, RP00206-20, RP00206-50, RP00206-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Angiopoietin-like 7/ANGPTL7(27-346) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln27-Pro346) of human Angiopoietin-like 7 (Accession #NP_066969.1) fused with a 6×His tag at the C-terminus.
Alternate Names: ANGPTL7, AngX, CDT6, dJ647M16.1
SWISS: O43827
GeneID: 10218
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Angiopoietin-like 7 (ANGPTL7), also known as Corneal-Derived Transcript 6 (CDT6), is a secreted glycoprotein that is structurally related to the angiopoietins. ANGPTL7 is expressed in the corneal stroma, trabecular meshwork, and sclera and is elevated in glaucoma aqueous humor. Its production is up regulated in trabecular meshwork cells by glucocorticoids and TGF-beta and in cartilage by TNF-alpha. Overexpression of ANGPTL7 in trabecular meshwork cells inhibits the production of collagen and proteoglycans. When overexpressed in tumor cells it promotes collagen and proteoglycan deposition but inhibits tumor xenograft progression and tumor angiogenesis.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ANGPTL7 at 5 μg/mL (100 μL/well) can bind Recombinant Human LILRB4 with a linear range of 0.5-3.5 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only