WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Angiopoietin-like 8/ANGPTL8 (22-198) Protein - RP02831

Recombinant Human Angiopoietin-like 8/ANGPTL8 (22-198) Protein - RP02831

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Angiopoietin-like 8/ANGPTL8 (22-198) Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02831-10, RP02831-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Angiopoietin-like 8/ANGPTL8(22-198) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala22-Ala198) of human Angiopoietin-like 8/ANGPTL8 (Accession #NP_061157.3) fused with a hFc tag at the N-terminus.

Alternate Names: Betatrophin; Angiopoietin-like protein 8; Lipasin; Angptl8; ANGPTL8

SWISS: Q6UXH0

GeneID: 55908

Species: Human

Purity: ≥ 80 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein specifically promotes pancreatic beta cell proliferation and beta cell mass expansion, thereby improving glucose tolerance. It promotes pancreatic beta cell proliferation without insulin resistance. Also it acts as a blood lipid regulator by regulating serum triglyceride levels and possibly by promoting ANGPTL3 cleavage. It interacts with ANGPTL3. It predominantly expressed in liver and also expressed in adipose tissues. The ability of the protein to induce pancreatic beta cell proliferation is promising in diabetes therapy. Betatrophin treatment could supply or replace insulin injections by increasing the number of insulin-producing cells in diabetes.

Source: HEK293 cells

Tag: N-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Antigen Sequence: APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only