Recombinant Human Apolipoprotein A-II/APOA2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01441-10, RP01441-20, RP01441-50, RP01441-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Apolipoprotein A-II/APOA2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala19-Gln100) of human Apolipoprotein A-II/APOA2 (Accession #NP_001634.1) fused with a Fc, Avi tag at the C-terminus.
Alternate Names: APOA2, Apo-AII, ApoA-II, apoAII, ApoA-II, apoAII
SWISS: P02652
GeneID: 336
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Apolipoprotein A-II(Apo-AII for short), also known as Apolipoprotein A2, is a secreted protein which belongs to the apolipoprotein A2 family. It exists as a disulfide-linked homodimer; and also can form a disulfide- linked heterodimer with APOD. APOA2 is the 2nd most abundant protein of the high density lipoprotein particles. This protein may stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. Defects in APOA2 gene might cause apolipoprotein A-II deficiency or hypercholesterolemia.
Source: HEK293 cells
Tag: C-hFc&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only