Recombinant Human Apolipoprotein B/APOB Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02796LQ-10, RP02796LQ-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Apolipoprotein B/APOB Protein is produced by E. coli expression system. The target protein is expressed with sequence (Glu28-Ser127) of human Apolipoprotein B/APOB (Accession #NP_000375.2) fused with a 6×His tag at the N-terminus.
Alternate Names: ApolipoproteinB-100; APOB
SWISS: P04114
GeneID: 338
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Source: E. coli
Tag: N-His
Formulation: Supplied as a 0.22 μm filtered solution in 20mM Tris-HCl, 250mMNacl, 10% Glycerol, 2mMEDTA, pH8.0.
Antigen Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only