Recombinant Human B7-H2/ICOSLG/CD275 Protein
Sizes: 50ug, 100ug
Catalogue Number: RP01163-50, RP01163-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human B7-H2/ICOSLG/CD275 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp19-Ser258) of human B7-H2/ICOSLG (Accession #NP_056074.1) fused with a 6×His tag at the C-terminus.
Alternate Names: ICOSLG, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, LICOS
SWISS: O75144-1
GeneID: 23308
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human B7-H2/ICOSLG at 1 μg/mL (100 μL/well) can bind Human ICOS/CD278 with a linear range of 2-14.8 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only