Recombinant Human B7-H3/CD276 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01020-10, RP01020-20, RP01020-50, RP01020-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Pro245) of human B7-H3 (Accession #NP_079516) fused with a 6×His tag at the C-terminus.
Alternate Names: CD276, 4Ig-B7-H3, B7-H3, B7H3, B7RP-2, CD276 antigen, 4Ig-B7-H3, B7-H3, B7H3, B7RP-2
SWISS: Q5ZPR3-2
GeneID: 80381
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human B7-H3 at 2 μg/mL (100 μL/well) can bind Anti-Human B7-H3 Antibody with a linear range of 1-4 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only