Recombinant Human BCEI/PS2/TFF1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01779-10, RP01779-20, RP01779-50, RP01779-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human BCEI/PS2/TFF1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu25-Phe84) of human BCEI/PS2/TFF1 (Accession #NP_003216.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: pS2; BCEI; HPS2; HP1.A; pNR-2; D21S21; TFF1
SWISS: P04155
GeneID: 7031
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Trefoil Factor 1 (TFF1), also known as pS2, is one of three structurally related secreted proteins that contain trefoil domains. These domains adopt a three-leaved conformation held together by conserved intrachain disulfide bonds. TFF1 is an approximately 7 kDa peptide that plays an important role in epithelial regeneration and wound healing (1). Mature human TFF1 shares 67% amino acid sequence identity with mouse and rat TFF1. It is expressed by goblet cells of the gastric and intestinal mucosa and by conjunctival goblet cells (2-5). TFF1 is a copper-binding protein that can form disulfide-linked homodimers, associate into disulfide-linked complexes with Gastrokine 2, and form non-covalent complexes with the mucin MUC5AC (4, 6-8). Copper enhances TFF1 homodimerization as well as its ability to promote epithelial cell motility, wound healing, and the colonization of H. pylori in stomach and colon epithelia (9, 10). TFF1 is down-regulated during the progression from gastritis to gastric dysplasia to gastric cancer, although it is up-regulated in breast and prostate cancers (11-13). TFF1 inhibits the formation of calcium oxalate crystals, and its excretion in the urine is reduced in patients with kidney stones (14).
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only