WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human BST-1/CD157 Protein - RP00541

Recombinant Human BST-1/CD157 Protein - RP00541

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Human BST-1/CD157 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP00541-20, RP00541-50, RP00541-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human BST-1/CD157 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly29-Lys292) of human CD157/BST1/ADP-ribosyl cyclase 2/Cyclic ADP-ribose hydrolase 2 (Accession #Q10588) fused with a 6×His tag at the C-terminus.

Alternate Names: BST1, CD157

SWISS: Q10588

GeneID: 683

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The cluster of differentiation (CD) system is a glycosyl phosphatidylinositol anchored membrane protein thatbelongs to the CD38 family.It is generally used in immunophynotyping. CD157 was discovered in a bonemarrow stromal cell line where it facilitates pre-B-cell growth. CD157 is a bifunctional ectoenzyme that exhibitsboth ADP-ribosyl cyclase and cyclic ADP ribose hydrolase activities followed with CD38. It plays a role inrheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Studieshave shown that this protein have a role in predicted to function as a cell surface receptor and animmunoregulatory molecule.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only