Recombinant Human BTLA/CD272 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01052-10, RP01052-20, RP01052-50, RP01052-100
Citations, Manuals and MSDS Available upon request.
Description: Active Recombinant Human BTLA Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys31-Thr134) of human BTLA (Accession #NP_001078826.1.) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: BTLA, BTLA1, CD272
SWISS: Q7Z6A9-2
GeneID: 151888
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant human BTLA at 3 μg/mL (100 μL/well) can bind Biotinylated Recombinant human HVEM with a linear range of 18-72 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVT
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only