Recombinant Human BTN3A2 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02153-10, RP02153-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human BTN3A2 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln30-Trp248) of human BTN3A2 (Accession #P78410) fused with a 6xHis tag at the C- terminus.
Alternate Names: BT3.2, BTF4, BTN3.2, CD277, BTN3A2
SWISS: P78410
GeneID: 11118
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Butyrophilin subfamily 3 member A2, also known as BT3.2, BTF3, BTF4 and BTN3A2, is a single-pass type I membrane protein. It is a member of the butyrophilin (BTN) family and the immunoglobulin (IG) superfamily. Mature human BTN3A2 is a 305 amino acid (aa) glycoprotein. It contains a 219 aa extracellular region with one V-type Ig-like domain, and a 65 aa cytoplasmic tail. The cytoplasmic region undergoes phosphorylation on two serines. There are three potential splice forms. BTN3A2 is postulated to be expressed on immune-related cells, as it has a structural similarity to MHC and CD80/CD86 molecules. It plays a role in T-cell responses in the adaptive immune response and inhibits the release of IFNG from activated T-cells.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only