WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Caspase-7/CASP7 Protein - RP03142

Recombinant Human Caspase-7/CASP7 Protein - RP03142

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Caspase-7/CASP7 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP03142-10, RP03142-20, RP03142-50, RP03142-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Caspase-7/CASP7 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gln303) of Human Caspase-7/CASP7(Accession #NP_001218.1) fused with a His tag at the C-terminus.

Alternate Names: CASP7, MCH3, Caspase-7, CASP-7, EC:3.4.22.60, Apoptotic protease Mch-3, CMH-1, ICE-like apoptotic protease 3, ICE-LAP3, Cleaved into: Caspase-7 subunit p20, Caspase-7 subunit p11

SWISS: P55210-1

GeneID: 840

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Caspase-7/CASP7 belongs to the cysteine-aspartic acid protease (caspase) family. Caspases play a role in the signal transduction pathways of apoptosis, necrosis and inflammation. There are two major classes of caspases: initiators and effectors. The initiator isoformsare activated by, and interact with, upstream adaptor molecules through protein-protein interaction domains known as CARD and DED. Effector caspases are responsible for cleaving downstream substrates and are sometimes referred to as the executioner caspases. Caspase 7 exists in lung, skeletal muscle, liver, kidney, spleen, heart, and moderately in testis. Caspase 7 cannot be detected in the brain. Caspase 7 functions in the activation cascade of caspases responsible for apoptosis execution. It cleaves and activates sterol regulatory element binding proteins (SREBPs). It proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp- -Gly-217' bond. Overexpression promotes programmed cell death.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only