Recombinant Human Cathepsin D Protein
Sizes: 10ug, 50ug, 100ug
Catalogue Numbers: RP00214-10, RP00214-50, RP00214-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Cathepsin D Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu21-Leu412) of human Cathepsin D/CTSD (Accession #NP_001900.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CLN10, CPSD, HEL-S-130P, Cathepsin D, CTSD
SWISS: P07339
GeneID: 1509
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Cathepsin D (CTSD), a well known lysosomal aspartyl protease and belongs to the peptidase C1 family. It is expressed in most cells and overexpressed in breast cancer cells. It is a major enzyme in protein degradation in lysosomes, and also involved in the presentation of antigenic peptides. cathepsin D is essential for proteolysis of proteins regulating cell growth and tissue homeostasis. CTSD secreted from human prostate carcinoma cells are responsible for the generation of angiostatin, a potent endogenous inhibitor of angiogenesis, suggesting its contribution to the prevention of tumor growth and angiogenesis-dependent growth of metastases.
Bio-Activity: Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is >747 pmol/min/μg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only