Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01985-10, RP01985-20, RP01985-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly28-Asn93) of Human CCL14/HCC-1/HCC-3(28-93) (Accession #NP_116739.1) fused with His at the C-terminus.
Alternate Names: CCL14, NCC2, SCYA14, C-C motif chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible cytokine A14, Cleaved into: HCC-1(3-74), HCC-1(4-74), HCC-1(9-74)
SWISS: Q16627
GeneID: 6358(9-74)
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Chemokine (C-C motif) Ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It isproduced as a protein precursor that is processed to generate a mature active protein containing 74 aminoacids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed invarious tissues including spleen, bone marrow, liver, muscle, and gut. CCL14 activates monocytes, but does notinduce their chemotaxis. Human CCL14 is located on chromosome 17 within a cluster of other chemokinesbelonging to the CC family.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only