WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CCL15/MIP-5/HCC-2 Protein - RP01966

Recombinant Human CCL15/MIP-5/HCC-2 Protein - RP01966

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human CCL15/MIP-5/HCC-2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01966-10, RP01966-20, RP01966-50, RP01966-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL15/MIP-5/HCC-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser46-Ile113) of Human CCL15/MIP-5/HCC-2 (Accession #NP_116741.2) fused with His at the C-terminus.

Alternate Names: CCL15, MIP5, NCC3, SCYA15, C-C motif chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage inflammatory protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible cytokine A15, Cleaved into: CCL15(22-92), CCL15(25-92), CCL15(29-92)

SWISS: Q16663

GeneID: 6359

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Chemokine ligand 15 (CCL15), also known as leukotactin-1, MIP5, MIP1 and HCC-2, is a small cytokine belonging to the C-C chemokine family. CCL15 is prevantly expressed in liver, small intestine, colon, and in certain leukocytes and macrophages of the lung. It is chemotactic for neutrophils, monocytes, and lymphocytes and elicits its effects by binding to cell surface chemokine receptors like CCR1 and CCR3.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only