WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CCL16/HCC-4 Protein - RP01595

Recombinant Human CCL16/HCC-4 Protein - RP01595

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human CCL16/HCC-4 Protein

Sizes: 10ug, 20ug

Catalogue Number: RP01595-10, RP01595-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL16/HCC-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Gln120) of Human CCL16/HCC-4 (Accession # O15467) fused with with His tag at the C-terminus.

Alternate Names: CCL16, ILINCK, NCC4, SCYA16, C-C motif chemokine 16

SWISS: O15467

GeneID: 6360

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CCL16/HCC-4 Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).

Antigen Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only