Recombinant Human CCL25/TECK Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01945-10, RP01945-20, RP01945-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CCL25/TECK Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Leu150) of Human CCL25/TECK(Accession #NP_000726.1&NP_005615.2) fused with a His tag at the C-terminus.
Alternate Names: CCL25, SCYA25, TECK, C-C motif chemokine 25, Chemokine TECK, Small-inducible cytokine A25, Thymus-expressed chemokine
SWISS: O15444
GeneID: 6370
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CCL25, also known as TECK, is a CC chemokine that regulates the trafficking of lymphocytes in the thymus and small intestine. Mature human CCL25 shares 40% amino acid sequence identity with mouse and rat CCL25. CCL25 is produced by stromal cells in the thymus and epithelial cells of the small intestine, particularly the jejunum and ileum. It binds to and induces chemoattraction through CCR9 , and both human and mouse proteins act on human CCR9. CCR9 is expressed on immature pre-T cells and thymocytes. In cancer, functional CCR9 mediates the metastasis of melanoma cells to the small intestine, contributes to the CCL25-dependent migration and invasion of some breast carcinomas , and attracts mesenchymal stromal cells to CCL25-expressing multiple myelomas. CCL25 contributes to the severity of chronic inflammation in rheumatoid arthritis where it attracts CCR9+ monocytes and macrophages, in endometriosis where it promotes the invasiveness of stromal cells, and in atherosclerosis where it contributes to the accumulation of CCR9+ macrophages in arterial plaques.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only