Recombinant Human CCL5/RANTES Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01611LQ-10, RP01611LQ-20, RP01611LQ-50, RP01611LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CCL5/RANTES Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser24-Ser91) of human CCL5/RANTES (Accession #NP_002976.2) fused with a 6×His tag at the C-terminus.
Alternate Names: D17S136E; eoCP; RANTES; SCYA5; SIS-delta; SISd; TCP228, CCL5
SWISS: P13501
GeneID: 6352
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCL5 (Catalog: RP01611LQ) at 2 μg/mL (100 μL/well) can bind Mouse CXCL4(Catalog: RP03170) with a linear range of 41.2-815 ng/mL.
Source: Pichia
Tag: C-His
Formulation: Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Antigen Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only