WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CD24 Protein - RP01229

Recombinant Human CD24 Protein - RP01229

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Human CD24 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP01229-10, RP01229-20, RP01229-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD24 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly59) of human CD24 (Accession #NP_037362) fused with a Fc tag at the C-terminus.

Alternate Names: CD24, CD24A, CD24 molecule, CD247

SWISS: P25063

GeneID: 100133941

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human CD24 at 2 μg/mL (100 μL/well) can bind Human Siglec10 with a linear range of 1-764 ng/mL.|2.Measured by its binding ability in a functional ELISA.Immobilized PE Mouse Anti-Human CD24 at 1μg/mL (25 μL/well) can bind Human CD24 with a linear range of 0.46-28.4ng/mL.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only