Recombinant human CD9 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01643-10, RP01643-20, RP01643-50, RP01643-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant human CD9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser112-Ile195) of human CD9 (Accession #NP_001760.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29; CD9
SWISS: P21926
GeneID: 928
Species: human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CD9 is a member of the transmembrane 4 superfamily, which is also known as the tetraspanin family. CD9 is a cell surface glycoprotein with 4 hydrophobic domains that are described as complex with integrins and other transmembrane 4 superfamily members. It is found expressed on the surface of the exosomes. The protein takes part in cellular signal transduction events and thus play a role in the regulation of cell development and activation, growth and motility. Besides, CD9 seems to be a key role in the egg-sperm fusion during the mammalian fertilization processes. CD9 is found on the membrane of the oocytes and also appears to intervene in maintaining the normal shape of oocyte microvilli.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only