Recombinant Human Chemerin/RARRES2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01808-10, RP01808-20, RP01808-50, RP01808-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Chemerin/RARRES2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Ser157) of human RARRES2/TIG2 (Accession #) fused with hFc tag at the C-terminus.
Alternate Names: TIG2; HP10433; RARRES2
SWISS: Q99969
GeneID: 5919
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Retinoic acid receptor responder protein 2 (RARRES2) is a small secreted protein involved in multiple cancers, including adrenocortical carcinoma (ACC). Serum RARRES2 may be used as a novel prognostic marker for ACC. Retinoic acid receptor responder 2 (RARRES2) is transcriptionally downregulated in multiple cancer types. Previous studies suggested that it can serve as an immune-dependent tumor suppressor by acting as a chemoattractant to recruit anticancer immune cells expressing its receptor, the chemerin chemokine receptor 1 (CMKLR1), to sites of tumor. Mechanistically, RARRES2 overexpression in ACC cells inhibited Wnt/beta-catenin pathway activity by promoting beta-catenin phosphorylation and degradation, it also inhibited the phosphorylation of p38 mitogen-activated protein kinase. Thus RARRES2 is a novel tumor suppressor for ACC, which can function through an immune-independent mechanism.
Source: HEK293 cells
Tag: C-hFC
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only