WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein - RP02873

Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein - RP02873

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02873-10, RP02873-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Gln165) of Human Choriogonadotropin subunit beta 3/CGB3 (Accession #NP_000728.1) fused with  6×His tag at the C-terminus.

Alternate Names: CGB3, CGB, CGB5, CGB7, CGB8, hCGB

SWISS: P0DN86

GeneID: 1082

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Antigen Sequence: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only