Recombinant Human CLEC7A/Dectin-1/CD369 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01523-10, RP01523-20, RP01523-50, RP01523-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CLEC7A/Dectin-1/CD369 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr66-Met247) of human CLEC7A/Dectin-1/CD369 (Accession #NP_922938.1) fused with a raFc tag at the N-terminus.
Alternate Names: CLEC7A, BGR, CANDF4, CLECSF12, DECTIN1, SCARE2, CD369
SWISS: Q9BXN2
GeneID: 64581
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Dectin-1 was recently identified as the most important receptor for beta-glucan. It is a type II transmembrane protein which binds beta-1,3 and beta-1,6 glucans, and is expressed on most cells of the innate immune system and has been implicated in phagocytosis as well as killing of fungi by macrophages, neutrophils and dendritic cells. Recognition of beta-glucan by dectin-1 triggers effective immune response, including phagocytosis and proinflammatory factor production, to eliminate infecting fungi, which especially benefits immunocompromised patients against opportunistic fungal infection. In addition, dectin-1 is involved in the adaptive immune response as well as autoimmune diseases and immune tolerance. Dectin-1 can recognize and respond to live fungal pathogens and is being increasingly appreciated as having a key role in the innate responses to these pathogens. In addition to its exogenous ligands, Dectin-1 can recognize an unidentified endogenous ligand on T cells and may act as a co-stimulatory molecule. Recent studies have highlighted the importance of Dectin-1 in anti-fungal immunity, in both mice and humans, and have suggested a possible involvement of this receptor in the control of mycobacterial infections.
Source: HEK293 cells
Tag: N-Rabbit Fc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only