Recombinant Human Collagen XV alpha 1/COL15A1 (S1195F) protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01851-10, RP01851-20, RP01851-50, RP01851-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Collagen XV alpha 1/COL15A1 (S1195F) protein is produced by HEK293 cells system. The target protein is expressed with sequence (Asn1133-Ser1381) of Human Collagen XV alpha 1/COL15A1 (S1195F)(Accession #NP_001846.3) fused with His and hFc tag at the N-Terminus.
Alternate Names: COL15A1, Collagen alpha-1(XV) chain, Restin
SWISS: P39059
GeneID: 1306
Species: Human
Purity: ≥ 90% as determined by reducing SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Collagen XV alpha 1/COL15A1 is a structural protein crucial for stabilizing microvessels and muscle cells, playing a key role in cardiac and skeletal muscle tissues. Its structural support contributes to microvascular and muscle integrity. Additionally, COL15A1 exhibits a potent anti-angiogenic effect, inhibiting angiogenesis and suggesting its role in regulating blood vessel formation.
Source: HEK293 cells
Tag: N-His＆hFc
Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).
Antigen Sequence: NLVTAFSNMDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPADSPPPPALFSNPHQLLPPPNPISSANYEKPALHLAALNMPFSGDIRADFQCFKQARAAGLLSTYRAFLSSHLQDLSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRDIMTDPSWPQKVIWHGSSPHGVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYSCANRLIVLCIENS
Endotoxin: < 0.01 EU/μg of the protein by LAL method.
Research Use Only