Recombinant Human Creatine Kinase MM/CKMM Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02817LQ-10, RP02817LQ-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Creatine Kinase MM/CKMM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys381) of human Creatine Kinase MM/CKMM (Accession #AAP35439.1) fused with a 6×His tag at the C-terminus.
Alternate Names: Creatine kinase M-type; Creatine kinase M chain; M-CK; CKM; CKMM
SWISS: P06732
GeneID: 1158
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: Creatine kinase M-type is also known as Creatine kinase M chain,M-CK. It is a protein that in humans is encoded by the CKM gene. It belongs to the ATP:guanido phosphotransferase family,containing 1 phosphagen kinase C-terminal domain and 1 phosphagen kinase N-terminal domain. Creatine kinase M-type can reversibly catalyzes the transfer of phosphate between ATP and various phosphogens. It plays a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
Source: HEK293 cells
Tag: C-His
Formulation: Supplied as a 0.22 μm filtered solution in 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5.
Antigen Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only