Recombinant Human CTLA-4/CD152 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01044-10, RP01044-20, RP01044-50, RP01044-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CTLA-4/CD152 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala37-Phe162) of human CTLA-4 (Accession #NP_005205.2) fused with a 6×His tag at the C-terminus.
Alternate Names: CTLA4, ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12
SWISS: P16410
GeneID: 1493
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized lpilimumab at 1 μg/mL (100 μL/well) can bind Recombinant Human CTLA-4 with a linear range of 6-18 ng/mL.|2.Measured by its binding ability in a functional ELISA.Immobilized PE anti-human CD152 (CTLA-4) Antibody at 1μg/mL (25 μL/well) can bind Human CTLA-4 with a linear range of 0.46-2.05 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only