WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CXCL1/GRO-alpha Protein - RP01651

Recombinant Human CXCL1/GRO-alpha Protein - RP01651

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human CXCL1/GRO-alpha Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01651-10, RP01651-20, RP01651-50, RP01651-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CXCL1/GRO-alpha Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL1/GRO-alpha (Accession #NP_001502.1) fused with no additional amino acid.

Alternate Names: FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a; CXCL1

SWISS: P09341-1

GeneID: 2919

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.

Source: Pichia

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only