Recombinant Human CXCL1/GRO-alpha Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01651-10, RP01651-20, RP01651-50, RP01651-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CXCL1/GRO-alpha Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL1/GRO-alpha (Accession #NP_001502.1) fused with no additional amino acid.
Alternate Names: FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a; CXCL1
SWISS: P09341-1
GeneID: 2919
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
Source: Pichia
Tag: NO-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only