WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CXCL12/SDF-1 Protein - RP01637

Recombinant Human CXCL12/SDF-1 Protein - RP01637

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human CXCL12/SDF-1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01637-10, RP01637-20, RP01637-50, RP01637-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CXCL12/SDF-1 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Lys22-Lys89) of human CXCL12/SDF-1 (Accession #NP_954637.1.) fused with no additional amino acid.

Alternate Names: IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12; CXCL12

SWISS: P48061-2

GeneID: 6387

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity).

Bio-Activity: Measured by its ability to chemoattract MOLT4 cells. The ED50 for this effect is 11.47-45.86 ng/mL, corresponding to a specific activity of 2.18×10^4 ~8.72×10^4 units/mg.

Source: Pichia

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only