Recombinant Human CXCL4/PF-4 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01774-10, RP01774-20, RP01774-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CXCL4/PF-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu32-Ser101) of human PF-4/CXCL4/SCYB4 (Accession #NP_002610.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: PF-4; CXCL4; SCYB4
SWISS: P02776
GeneID: 5196
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CXCL4, or Platelet factor 4 (PF4), is a small cytokine belonging to the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. CXCL4 is chemotactic for neutrophils and monocytes and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. CXCL4/PF4 is up-regulated in human liver fibrosis and that it plays a nonredundant, functional role in experimental liver fibrosis by mediating stellate cell proliferation, migration, and intrahepatic immune cell recruitment.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 10 mM Sodium Citrate,150 mM NaCl,pH5.0.
Antigen Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only