Recombinant Human Decorin/PG-S2/DCN Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02157-10, RP02157-20, RP02157-50, RP02157-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Decorin Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp31-Lys359) of human Decorin (Accession #P07585) fused with a hFC tag at the C- terminus.
Alternate Names: DCN, CSCD, DSPG2, PG40, PGII, PGS2, SLRR1B, decorin, Decorin
SWISS: P07585
GeneID: 1634
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Decorin is a secreted chondroitin/dermatan sulfate proteoglycan in the family of small leucine-rich proteoglycans (SLRPs). SLRP family members are characterized by N-terminal and C-terminal cysteine-rich regions which flank the central region containing 10-12 tandem leucine-rich repeats (LRR). The human Decorin cDNA encodes a 359 amino acid (aa) precursor that includes a 16 aa signal sequence and a 14 aa propeptide. Alternate splicing of human Decorin generates five isoforms with variable length deletions. Decorin is an N-glycosylated protein that also carries a variablysized hybrid chondroitin/dermatan sulfate chain at Ser34. Decorin regulates assembly of the extracellular collagen matrix and the bioactivity of the matrix associated growth factors FGF2,GDF8/Myostatin, TGFβ,and WISP1. It also binds and activates EGF R, ErbB4, and IGFI-R. In vivo, Decorin promotes myoblast differentiation, supports angiogenesis, and inhibits tumor progression.
Source: HEK293 cells
Tag: C-hFC
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only