WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human E-selectin/SELE/CD62E Protein - RP00293

Recombinant Human E-selectin/SELE/CD62E Protein - RP00293

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Human E-selectin/SELE/CD62E Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00293-10, RP00293-20, RP00293-50, RP00293-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human E-selectin/SELE/CD62E Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Trp22-Pro556) of human E-Selectin/CD62E (Accession #NP_000441.2) fused with a 6×His tag at the C-terminus.

Alternate Names: SELE, CD62E, ELAM, ELAM1, ESEL, LECAM2

SWISS: P16581

GeneID: 6401

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis.

Bio-Activity: Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104cells/well are added to human E-Selectin/His Chimera coated plates (2 μg/mL with 100 μL/well), approximately 40-50% will adhere after 1 hour incubation at 37℃.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Endotoxin: Please contact us for more information.

Research Use Only