WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein - RP00246

Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein - RP00246

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00246-10, RP00246-20, RP00246-50, RP00246-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val26-Gln205) of human Fc epsilon RI alpha (Accession #NP_001992) fused with a 6×His tag at the C-terminus.

Alternate Names: FCER1A, FCE1A, FcERI

SWISS: P12319

GeneID: 2205

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: FCER1A is the alpha subunit of the immunoglobulin epsilon receptor (IgE receptor). IgE receptor is a high affinity IgE receptor which plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. IgE receptor is comprised of an alpha subunit(FcERI), a beta subunit, and two gamma subunits. FcERI is glycosylated and contains 2 Ig-like (immunoglobulin-like) domains.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized FITC anti-human FcεRIα Antibody at 1μg/mL (25 μL/well) can bind Human Fc epsilon RI alpha with a linear range of 0.46-3.15 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only